DocSpera is revealing our new ASC Solutions Package for providers to optimize their workflows CLICK HERE

Automated, SMS-Based Digital Outcomes Collection

Patient
Outcome Reporting

Robust and care-focused solution designed
for your patients to engage, communicate,
and collect outcomes

Collaboration with

LainaHealth logo
phone-in-hand-showing-outcome-report

Focus on the Patient

50%+

Patient Response Rate via Text Message

We’ve Got you Covered

90%+

Outcome Collection Cost Savings

The Patient is Your Domain

92%

Patient Satisfaction

Read more about our Outcomes Collection

Deliver High Patient SatisfactionWhile Meeting Your Quality Metrics

check-bullet

High Patient Adoption and Retention: Increased and consistent data capture

check-bullet

Automated and Integrated: Automatic onboarding of patients via EMR integration

check-bullet

Standardized Data Protocol: Meaningful data capture to be used for RPM/RTM, Payor reimbursement negotiation and PROM certification

check-bullet

Smart Patient Engagement: Engage patients through proactive two-way communication

9:31

cellullarwifibattery
DocSpera Practice arrow

Hi John,

Thank you for choosing me as your surgeon. You are now enrolled in a text messaging service. Over the next few months, you'll receive text message reminders from my office with helpful recovery tips and reminders related to your surgery.

Regards,
DocSpera Practice

Hi, John,

You are scheduled to have a total knee replacement.

You can expect your scar to be right on your knee.

It's a great choice, and the right one for your knee!

Regards,
DocSpera Practice

Hi John,

We're going to teach you how to move around your home safely after surgery, including how to get in and out of bed and how to get in and out of a chair. Be sure to practice these techniques at least once before surgery.

https://www.youtube.com/watch?v=JGPEsTR5TNc

https://youtu.be/X_KMEJ7rYLc?si=_D7oS4OEpK7OMvkU

Regards,
DocSpera Practice

Hi, John,

Adhering to physical therapy after surgery is important for your recovery, so it would be beneficial to spend a few minutes each day practicing exercises you will want to do after surgery.

Here are some your physical therapy team might suggest:

https://youtu.be/KB--k_lz5bk?si=OMMUzSU0OASihybJ

Regards,
DocSpera Practice

In order to track your progress, we will be asking you to complete critical questions and movements using your phone, tablet or computer camera. This will be your first one before surgery. Please click the following link to complete the survey:

https://docspera.survey.co/survey/d5cbd13e-e987-4832-bfb5-c87014d9f119/welcome

Hi, John,

It's normal to have some pain after surgery once the block and anesthetics wear off. Focus on resting, icing, and elevating your joint and gentle exercises when the swelling and pain feel more intense.
HSometimes the exercises can make your pain better, but take it slow

You may notice mild bruising in your thigh or leg. This is normal, and the bruising may even follow gravity to your toes. Elevation and icing are the best things to do to reduce this.

Good exercises to do to keep the blood flowing in your leg are ankle pumps. You can do these several times throughout the day.

https://www.youtube.com/watch?v=KxfFzSOAT7g

Also, if you were prescribed a blood thinner like aspirin, Xarelto, or Lovenox, be sure you are taking it.

Regards,
DocSpera Practice

Hi John,

Keep in mind, walking is a great rehab activity, but too much walking can be counterproductive. Do a few short walks each day, but keep each walk to no more than 5 minutes.

Regards,
DocSpera Practice

Hi John,

Congratulations on making it to week 2! You're doing great! Now that you are 2 weeks in, message updates will be a little less frequent but still check for messages regardless.

Make sure to continue your prescribed medications, don't try to wean yourself without discussing it with me first.

It's now ok to resume any vitamins and supplements you may have been taking before your surgery, but make sure you consult with your primary care physician.

Regards,
DocSpera Practice

Hi John,

While your scar should be mostly or completely healed, your bone takes 6-8 weeks to heal and 3-12 months to really strengthen. Since your bone is still healing, you may feel some aching around your knee. If this is the case, you may have done a little too much. Stay off your feet for a day and see if it feels better the next day.

Regards,
DocSpera Practice

Plus

Text Message

Microphone

Features of the Patient Outcome Reporting

Smart Text Alerts
PROM Data Collection
Mobility Screening
Interactive co-pilot
Patient Progress Tracker
Hi,
Thank you for choosing Prompt as your joint replacement communication. You are now enrolled in a text messaging service. Over the next few months, you'll receive text messaging reminders from my staff with helpful recovery tips and reminders related to your surgery.
I've sent you our contact information. It's important to save this to your contacts so you know these messages are sent automatically from our care team.
Docspera Practice
Docspera Icon
Plus

Text Message

Microphone

Personalized Smart Text Alerts

Large care binders and pamphlets are unnecessary. Keep education and communication simple to reduce patient anxiety and stress. Guide your patients with a simple and relevant care message at the right time. Procedure and timeline-based messages to drive timely care engagement.

Curated texts get read within minutes than a pamphlet

DocSpera and LainaHealth streamlines PRO-PM mandatory PROMS and functional test collection

Utilizing proprietary webAI and computer vision technology deployed via automatic text messaging from an existing clinical database not an organizational cost of $128 per data set

check-bullet

Save time and allow staff to solely focus on the patient without burden on manually collecting PROMS

check-bullet

Reduce cost by eliminating staff effort and licensing/data maintenance fees

check-bullet

Empower clinicians and health care organizations by enabling remote collecting PROMS while tracking patient's functional status

Read more in detail about our outcomes collectionchevron-white

50+%

Overall Capture
Rate

90%

down-arrow

Outcomes
Coolection Cost
Savings

92%

Patient
Satisfaction

Our Certifications And Relationships Across Healthcare Software Position Us As The Best Platform Available

one-medical-passportmodernizing-medicineathena healthe-clinical-workshst-pathwayscmscentricityprime-clinical-systemsmedentcernernext-gen-healthcareapp orchardelation-healthcareall-scriptsdr-chronogreenway-healthsrs-healthsurgical-information-systems

Start Focusing on Surgeries, Not Systems.

Let DocSpera start revolutionizing your surgical coordination.

  • Comprehensive product tour
  • No obligations
  • Trusted by surgeons and device partners nationwide
computer-software